(data stored in ACNUC7421 zone)

EMBL: CP001791.PE253

CP001791.PE253       Location/Qualifiers
FT   CDS             274378..275727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0263"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: ppd:Ppro_2155 amino acid carrier protein;
FT                   TIGRFAM: amino acid carrier protein; PFAM: sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97805"
FT                   /db_xref="GOA:D6XWG3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG3"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADH97805.1"
FT                   /translation="METVEHLINTASSFVWGLPLIVLLVGTGLYLTVRLAFFSFQQLPY
FT                   ALKLVFTKGDQVSKGDITHFQALMTALAATVGTGNIAGVASAVAVGGPGAVLWMWITAF
FT                   VGMATKYGEAILGVKYRVQNERGEMSGGPMYYIEKGLGMKWLAVIFAAFAAVAAFGIGN
FT                   MVQSHEAAGVANQNFGVPVWVTGLVLSVLVGLVIIGGIRSIGKVVGIVVPVMIVFYVGA
FT                   GLLIVLMNVADVPAAFGLIFTDAFTGQAMAGGAVGAVIQQGVARGIFSNEAGLGTGGIA
FT                   AAAAKTDVPARQALVSMTQVFIDTIIVCTITGLALVMSQMYLRADEFDSSAQLTSAAFE
FT                   QYLPGVGGIIVAVALLFFVFSTIVGWSYFGEKCFTYLLGGKVSMPYRFLFVIMLFVGSV
FT                   VSLDIVWGFADVMNGLMAFPNLVALLLLSGVIVNETKKFKQKRIEEKNAS"
     METVEHLINT ASSFVWGLPL IVLLVGTGLY LTVRLAFFSF QQLPYALKLV FTKGDQVSKG        60
     DITHFQALMT ALAATVGTGN IAGVASAVAV GGPGAVLWMW ITAFVGMATK YGEAILGVKY       120
     RVQNERGEMS GGPMYYIEKG LGMKWLAVIF AAFAAVAAFG IGNMVQSHEA AGVANQNFGV       180
     PVWVTGLVLS VLVGLVIIGG IRSIGKVVGI VVPVMIVFYV GAGLLIVLMN VADVPAAFGL       240
     IFTDAFTGQA MAGGAVGAVI QQGVARGIFS NEAGLGTGGI AAAAAKTDVP ARQALVSMTQ       300
     VFIDTIIVCT ITGLALVMSQ MYLRADEFDS SAQLTSAAFE QYLPGVGGII VAVALLFFVF       360
     STIVGWSYFG EKCFTYLLGG KVSMPYRFLF VIMLFVGSVV SLDIVWGFAD VMNGLMAFPN       420
     LVALLLLSGV IVNETKKFKQ KRIEEKNAS                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page