(data stored in ACNUC7421 zone)

EMBL: CP001791.PE254

CP001791.PE254       Location/Qualifiers
FT   CDS             275883..276236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97806"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97806.1"
FT                   /translation="MSSMNKVIAGDYEGWSVRSHAGSIHLVYKRDDRELTPETVAEWRE
FT                   LEPVTWNEQNMFSSKSLLGSLFLGPLDFLFGISSKTVKLYQLAFKCDDGMKGIMTVDID
FT                   VYHTFLKRFQNEG"
     MSSMNKVIAG DYEGWSVRSH AGSIHLVYKR DDRELTPETV AEWRELEPVT WNEQNMFSSK        60
     SLLGSLFLGP LDFLFGISSK TVKLYQLAFK CDDGMKGIMT VDIDVYHTFL KRFQNEG          117
//

If you have problems or comments...

PBIL Back to PBIL home page