(data stored in ACNUC7421 zone)

EMBL: CP001791.PE26

CP001791.PE26        Location/Qualifiers
FT   CDS             40519..40926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0027"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="KEGG: hha:Hhal_1881 GTP cyclohydrolase I; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97578"
FT                   /db_xref="GOA:D6XV20"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV20"
FT                   /inference="protein motif:TFAM:TIGR03139"
FT                   /protein_id="ADH97578.1"
FT                   /translation="MSENYYLPRSGPMPRPASVEEGRNVLRDEAFPAPDVSVVRFKALE
FT                   FTAVCPKTGQPDFGQVEIEYVPRNKCIESKSLKFYLWSYRDEGAYCESLAAQIADDVMA
FT                   AIEPARVKVMVHQTPRGGIQLETEAERIHEA"
     MSENYYLPRS GPMPRPASVE EGRNVLRDEA FPAPDVSVVR FKALEFTAVC PKTGQPDFGQ        60
     VEIEYVPRNK CIESKSLKFY LWSYRDEGAY CESLAAQIAD DVMAAIEPAR VKVMVHQTPR       120
     GGIQLETEAE RIHEA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page