(data stored in ACNUC7421 zone)

EMBL: CP001791.PE263

CP001791.PE263       Location/Qualifiers
FT   CDS             281673..283115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0273"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: psb:Psyr_2867 sensor histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97815"
FT                   /db_xref="GOA:D6XWH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH97815.1"
FT                   /translation="MPIHKKGVSLSRYWTVRYAVTIVIGVVILSLLAMYVIRQDALNTR
FT                   LDTMTFLAEDLAVGLDEEDLQAFADSRQRGRFRAGNRQLMNLEADVTVVITDEEGRILF
FT                   RNDTGMGRQEGVLEEAILNSLATPVRLGDEGSASYYAVSHPVRDETGGTAGFVVMKEKE
FT                   AVLTEANEQYTLLAIVAGAVILFGVLVTAVMARRLSMPIQEAANAAQRVRGGDYETTVP
FT                   ASTGIEEVDELNRSFSEMTRQLSDAEQLRKELLAGVTHELKTPITAITGLLEAVQEGVV
FT                   EGEEAEEFLAMSLTETAQLKRMITDLLTFNQFSSGHVPIRQEAVELKRFLEGIIRVGQA
FT                   DGAYGRTEIDLICEEAGGSCVAQADPMRLEQVLHNLIRNASEAMDGEGAMTLRCYSDSS
FT                   SCVIEVRDDGPGMPIDDQLHMFERFYRGTRTSGTKTGLGLGLPLSCMMMEAMDGRLAFI
FT                   ESGEQGTVFRLFLCAVNEEGSS"
     MPIHKKGVSL SRYWTVRYAV TIVIGVVILS LLAMYVIRQD ALNTRLDTMT FLAEDLAVGL        60
     DEEDLQAFAD SRQRGRFRAG NRQLMNLEAD VTVVITDEEG RILFRNDTGM GRQEGVLEEA       120
     ILNSLATPVR LGDEGSASYY AVSHPVRDET GGTAGFVVMK EKEAVLTEAN EQYTLLAIVA       180
     GAVILFGVLV TAVMARRLSM PIQEAANAAQ RVRGGDYETT VPASTGIEEV DELNRSFSEM       240
     TRQLSDAEQL RKELLAGVTH ELKTPITAIT GLLEAVQEGV VEGEEAEEFL AMSLTETAQL       300
     KRMITDLLTF NQFSSGHVPI RQEAVELKRF LEGIIRVGQA DGAYGRTEID LICEEAGGSC       360
     VAQADPMRLE QVLHNLIRNA SEAMDGEGAM TLRCYSDSSS CVIEVRDDGP GMPIDDQLHM       420
     FERFYRGTRT SGTKTGLGLG LPLSCMMMEA MDGRLAFIES GEQGTVFRLF LCAVNEEGSS       480
//

If you have problems or comments...

PBIL Back to PBIL home page