(data stored in ACNUC7421 zone)

EMBL: CP001791.PE264

CP001791.PE264       Location/Qualifiers
FT   CDS             283096..284982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0274"
FT                   /product="shikimate kinase"
FT                   /note="PFAM: shikimate kinase; KEGG: Os06g0225800;
FT                   hypothetical protein; K00891 shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97816"
FT                   /db_xref="GOA:D6XWH4"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH4"
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /protein_id="ADH97816.1"
FT                   /translation="MRRDHHEIVITGIACVGKSTVGQLLAERMGHVFYDLDLEIEQAFG
FT                   MPISRIKEQITTEREYRKKTAPVLEKLMQGRDWVIASTPSGLKDHYWKLIEKDPEIVTV
FT                   VLRDRAARIVERLTFYDDDSRLIPSPVTAANRHLYERDIQQDMTYYGTSHRKADVKFQI
FT                   KGRPANQAAEALYEEIMAFTPKDKEKEKVAETLVEYDDREPVVCDVPHPLVQDYDRLLR
FT                   FMMEKDVYVTKKKREISSVFLPELNGLLALKRPASVKGKAQAAYPVIHLFFTLAINSGL
FT                   LAIQEGPRGRMYVKADEERLRAYRQLSDLEIYYLLLETLWTDTDWANVTDRGKTEHVYL
FT                   FQKVLIQIVRHARPGEPFPVRRDWVDRFADYFSWFAFWTEAEDEEYRTFEQQEPGFRNV
FT                   FVLVHVHRDAKERIQTLLFDRNLEQWNLPFRKVTGELNPQPGDAAKEWFGLDEEDEFER
FT                   QLQEAIGIDRRHEAFFEAFVSLHSEEVIERTLPRNVVSFEPGLHMLRITYLSVSREMIV
FT                   SQETTLAELHGMILEAFDLTDDHLYAFFLDGILYSEPAVYAPQADEEHRADEVTIGSLG
FT                   LRKGQSFVYVYNFVHEIILDIDVCFVDDRAEVTDVRSFGDAIGHPPWSDEGV"
     MRRDHHEIVI TGIACVGKST VGQLLAERMG HVFYDLDLEI EQAFGMPISR IKEQITTERE        60
     YRKKTAPVLE KLMQGRDWVI ASTPSGLKDH YWKLIEKDPE IVTVVLRDRA ARIVERLTFY       120
     DDDSRLIPSP VTAANRHLYE RDIQQDMTYY GTSHRKADVK FQIKGRPANQ AAEALYEEIM       180
     AFTPKDKEKE KVAETLVEYD DREPVVCDVP HPLVQDYDRL LRFMMEKDVY VTKKKREISS       240
     VFLPELNGLL ALKRPASVKG KAQAAYPVIH LFFTLAINSG LLAIQEGPRG RMYVKADEER       300
     LRAYRQLSDL EIYYLLLETL WTDTDWANVT DRGKTEHVYL FQKVLIQIVR HARPGEPFPV       360
     RRDWVDRFAD YFSWFAFWTE AEDEEYRTFE QQEPGFRNVF VLVHVHRDAK ERIQTLLFDR       420
     NLEQWNLPFR KVTGELNPQP GDAAKEWFGL DEEDEFERQL QEAIGIDRRH EAFFEAFVSL       480
     HSEEVIERTL PRNVVSFEPG LHMLRITYLS VSREMIVSQE TTLAELHGMI LEAFDLTDDH       540
     LYAFFLDGIL YSEPAVYAPQ ADEEHRADEV TIGSLGLRKG QSFVYVYNFV HEIILDIDVC       600
     FVDDRAEVTD VRSFGDAIGH PPWSDEGV                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page