(data stored in ACNUC7421 zone)

EMBL: CP001791.PE265

CP001791.PE265       Location/Qualifiers
FT   CDS             complement(285052..286134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0275"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: vfm:VFMJ11_A1186 flavin
FT                   monoamine oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97817"
FT                   /db_xref="GOA:D6XWH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH5"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADH97817.1"
FT                   /translation="MPETTIIIGAGLSGLYAASLLHKRGLPVCVLETRPRTGGRILSKT
FT                   VPDRPELGRFDLGPTWYWPEHEPLITDVIDTLGLEAFEQYTAGDILLERSENAPLERHT
FT                   LPPGAQPRAMRLAGGIGRLTDALYDSLPDGTVALETAVTDLTLNVDGSIRVGGTGRDNR
FT                   PFYLDGTRVITALPPRLLAERITFDPALPNGLHAALRSTPTWMAGHAKAVAVYDTPFWR
FT                   EDGLSGQAMSWAGPLQEIHDASPNNGSGALFGFFGIDAKARQSPGEPGLKEAVTDQLMR
FT                   LFGKSAGKPIEVLIYDWARDSFTATSLDERLAEPASFPGPVSLWDGRLLFAGTETDPSS
FT                   GGHLEGALQAGKRAADAVTD"
     MPETTIIIGA GLSGLYAASL LHKRGLPVCV LETRPRTGGR ILSKTVPDRP ELGRFDLGPT        60
     WYWPEHEPLI TDVIDTLGLE AFEQYTAGDI LLERSENAPL ERHTLPPGAQ PRAMRLAGGI       120
     GRLTDALYDS LPDGTVALET AVTDLTLNVD GSIRVGGTGR DNRPFYLDGT RVITALPPRL       180
     LAERITFDPA LPNGLHAALR STPTWMAGHA KAVAVYDTPF WREDGLSGQA MSWAGPLQEI       240
     HDASPNNGSG ALFGFFGIDA KARQSPGEPG LKEAVTDQLM RLFGKSAGKP IEVLIYDWAR       300
     DSFTATSLDE RLAEPASFPG PVSLWDGRLL FAGTETDPSS GGHLEGALQA GKRAADAVTD       360
//

If you have problems or comments...

PBIL Back to PBIL home page