(data stored in ACNUC7421 zone)

EMBL: CP001791.PE266

CP001791.PE266       Location/Qualifiers
FT   CDS             complement(286155..286562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0276"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ara:Arad_4048 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97818"
FT                   /db_xref="GOA:D6XWH6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH97818.1"
FT                   /translation="MYKGLGHIALTVADMDASISFYCRQLGFEEAFAIHDDEGNPWIEY
FT                   IKIAPGQFIELFHGGRVHVETAPGTIGFNHLCVEVTDMAALVRHLNEQGVPIDVGPLRG
FT                   KDFNEQCWVTDPDGNPIEFMAIDPRSPHVKS"
     MYKGLGHIAL TVADMDASIS FYCRQLGFEE AFAIHDDEGN PWIEYIKIAP GQFIELFHGG        60
     RVHVETAPGT IGFNHLCVEV TDMAALVRHL NEQGVPIDVG PLRGKDFNEQ CWVTDPDGNP       120
     IEFMAIDPRS PHVKS                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page