(data stored in ACNUC7421 zone)

EMBL: CP001791.PE267

CP001791.PE267       Location/Qualifiers
FT   CDS             complement(286555..287619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0277"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11;
FT                   Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 12; KEGG: abo:ABO_0828 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97819"
FT                   /db_xref="GOA:D6XWH7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH97819.1"
FT                   /translation="MWYEPVLSRNLVPDRTLRIAVRRLLKNRLEDLQFPSVSERQAYVT
FT                   RFIDALEDKPIAVHTDDANEQHYELPAAFFSRVLGDHLKYSSGYWPEGLSLDDRDALTA
FT                   SEEAMLALTCERADLRNGQAILELGCGWGSLSLFMARRYPGSIITVLSNSASQKAYIDH
FT                   QIAKEKLSNLTVITADINDFSTDDRFDRVVSVEMFEHMQNQKRLMNKIKGFLVPGGKLF
FT                   IHIFSHKDTPYLFEVKSSGDWMAKYFFTGGMMPSHHLPLYMAGTLAIEEHWAVSGLHYH
FT                   KTCEAWLREMDRQKDTIMPLFREVYGKREARRWWVYWRIFFIACSELFRYNDGNEWHVS
FT                   HYLFRKETEEDAHV"
     MWYEPVLSRN LVPDRTLRIA VRRLLKNRLE DLQFPSVSER QAYVTRFIDA LEDKPIAVHT        60
     DDANEQHYEL PAAFFSRVLG DHLKYSSGYW PEGLSLDDRD ALTASEEAML ALTCERADLR       120
     NGQAILELGC GWGSLSLFMA RRYPGSIITV LSNSASQKAY IDHQIAKEKL SNLTVITADI       180
     NDFSTDDRFD RVVSVEMFEH MQNQKRLMNK IKGFLVPGGK LFIHIFSHKD TPYLFEVKSS       240
     GDWMAKYFFT GGMMPSHHLP LYMAGTLAIE EHWAVSGLHY HKTCEAWLRE MDRQKDTIMP       300
     LFREVYGKRE ARRWWVYWRI FFIACSELFR YNDGNEWHVS HYLFRKETEE DAHV             354
//

If you have problems or comments...

PBIL Back to PBIL home page