(data stored in ACNUC7421 zone)

EMBL: CP001791.PE268

CP001791.PE268       Location/Qualifiers
FT   CDS             complement(287746..288210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0278"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   rpf:Rpic12D_4528 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97820"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH97820.1"
FT                   /translation="MTNLFPRRNRSSNPFFPGNSLFPTLFDSGSLSDFFTGDLLNDSGF
FT                   PRVDIEDKGDYYKIEADLPGFQKDDVVVEFDNGYLTIHGKHETTEETEDKERNFVRKER
FT                   SSGSFHRSFYVGDINGDDINGSFKNGVLTVTVPKTDKETPDTTKRISLDD"
     MTNLFPRRNR SSNPFFPGNS LFPTLFDSGS LSDFFTGDLL NDSGFPRVDI EDKGDYYKIE        60
     ADLPGFQKDD VVVEFDNGYL TIHGKHETTE ETEDKERNFV RKERSSGSFH RSFYVGDING       120
     DDINGSFKNG VLTVTVPKTD KETPDTTKRI SLDD                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page