(data stored in ACNUC7421 zone)

EMBL: CP001791.PE270

CP001791.PE270       Location/Qualifiers
FT   CDS             290291..291298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0280"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: aeh:Mlg_1052 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97822"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97822.1"
FT                   /translation="MNGQSQTEEALHQALDHYYDVYFRRGDIRETLALVDGDSTGAGTG
FT                   AGEMAYTYDDVVRLYKQDLGQAPNEVHFEELSRTVTALNPDSGLTFSLLNLETEIMHQR
FT                   LKFNQLRLTMVWRRDQKDQVFKIVHLHASFPTNEHEADESYPVKELEERNRVLERLVQD
FT                   RTRELELSLEQQRDAASTDRLTGLRNRASLEDLLEMEINRAVQEEAVFAVILMDMDHFK
FT                   RINDTHGHQAGDSCLKELAELLIRQSRPTDIVGRWGGEEFLIICPNTDERGSKDLAESF
FT                   RLAVSAYRFTKTGAQTASFGVAAFMTGDDGETLIGRADRALYRAKGAGRNRVEV"
     MNGQSQTEEA LHQALDHYYD VYFRRGDIRE TLALVDGDST GAGTGAGEMA YTYDDVVRLY        60
     KQDLGQAPNE VHFEELSRTV TALNPDSGLT FSLLNLETEI MHQRLKFNQL RLTMVWRRDQ       120
     KDQVFKIVHL HASFPTNEHE ADESYPVKEL EERNRVLERL VQDRTRELEL SLEQQRDAAS       180
     TDRLTGLRNR ASLEDLLEME INRAVQEEAV FAVILMDMDH FKRINDTHGH QAGDSCLKEL       240
     AELLIRQSRP TDIVGRWGGE EFLIICPNTD ERGSKDLAES FRLAVSAYRF TKTGAQTASF       300
     GVAAFMTGDD GETLIGRADR ALYRAKGAGR NRVEV                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page