(data stored in ACNUC7421 zone)

EMBL: CP001791.PE271

CP001791.PE271       Location/Qualifiers
FT   CDS             complement(291364..292968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0281"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tcx:Tcr_1143 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97823"
FT                   /db_xref="GOA:D6XWI1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97823.1"
FT                   /translation="MKQLDTIQANKEGDPIKSPQPFQLNKKRLFLLLALGLLFMSLLGL
FT                   LFNRTYVSTKESYMGAEMDAFESKIYTTLELYENFSDFIFEEHINQDDVLALVEQGVFG
FT                   TEDEQNAARRMLFSELSETYDAVLNYDFRQLHFHTREGDSFLRFHAPELYGDSLMDIRD
FT                   SIRMANTEERFVFGFEEGRIFNGYRFVYPLHRNGRHLGSVEVSISMGSLVQMIGSLYPD
FT                   DVLTFVIREDIVRDTVFESEQTNYSTAPFFPGYALDEGISSQSERCVCDTAFSMNCSVI
FT                   ETIVSDNEELTGEGASFNRLTTQNGQDVLVNFLSVTNLSDQHVAYLIGMHEIEDGSVFG
FT                   HYHLNRDLALLALFFSFYAYSIFMYERKQKQLGILANTDQLTGLFNRHYMMKQLEDNRQ
FT                   KGSGFKQPAILILLDIDRFKRINDEFGHQTGDAVLSETGALLHKLAGSHGTAARWGGEE
FT                   FVLYLPGYAKAEGTAFAEQVRSAIETHAYSKGLSVTASIGVSSTEDPDTPHIDALVQRA
FT                   DHKMYEAKEAGRNLVKA"
     MKQLDTIQAN KEGDPIKSPQ PFQLNKKRLF LLLALGLLFM SLLGLLFNRT YVSTKESYMG        60
     AEMDAFESKI YTTLELYENF SDFIFEEHIN QDDVLALVEQ GVFGTEDEQN AARRMLFSEL       120
     SETYDAVLNY DFRQLHFHTR EGDSFLRFHA PELYGDSLMD IRDSIRMANT EERFVFGFEE       180
     GRIFNGYRFV YPLHRNGRHL GSVEVSISMG SLVQMIGSLY PDDVLTFVIR EDIVRDTVFE       240
     SEQTNYSTAP FFPGYALDEG ISSQSERCVC DTAFSMNCSV IETIVSDNEE LTGEGASFNR       300
     LTTQNGQDVL VNFLSVTNLS DQHVAYLIGM HEIEDGSVFG HYHLNRDLAL LALFFSFYAY       360
     SIFMYERKQK QLGILANTDQ LTGLFNRHYM MKQLEDNRQK GSGFKQPAIL ILLDIDRFKR       420
     INDEFGHQTG DAVLSETGAL LHKLAGSHGT AARWGGEEFV LYLPGYAKAE GTAFAEQVRS       480
     AIETHAYSKG LSVTASIGVS STEDPDTPHI DALVQRADHK MYEAKEAGRN LVKA             534
//

If you have problems or comments...

PBIL Back to PBIL home page