(data stored in ACNUC7421 zone)

EMBL: CP001791.PE272

CP001791.PE272       Location/Qualifiers
FT   CDS             complement(293243..293812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0282"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: eba:ebA6393 putative glutathione peroxidase
FT                   protein; PFAM: glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97824"
FT                   /db_xref="GOA:D6XWI2"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI2"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADH97824.1"
FT                   /translation="MSVYDFKVKTSSGLNAPLNRYQGKVLLIVNTATKCGFTPQLDDLQ
FT                   KLQDQYGEQGLQILGFPSNQFDNQEPLGDGEITEFCSLNYGVNFPLFKKIDVRGEDAHP
FT                   LYQHLTKAKPFNGFDMDHPTAKLMVSIIESKHPEYMLDDGIKWNFTKFLIDRNGEVTAR
FT                   FEPTVEPFDMKADIEALLQSETALNQ"
     MSVYDFKVKT SSGLNAPLNR YQGKVLLIVN TATKCGFTPQ LDDLQKLQDQ YGEQGLQILG        60
     FPSNQFDNQE PLGDGEITEF CSLNYGVNFP LFKKIDVRGE DAHPLYQHLT KAKPFNGFDM       120
     DHPTAKLMVS IIESKHPEYM LDDGIKWNFT KFLIDRNGEV TARFEPTVEP FDMKADIEAL       180
     LQSETALNQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page