(data stored in ACNUC7421 zone)

EMBL: CP001791.PE273

CP001791.PE273       Location/Qualifiers
FT   CDS             296795..297718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0284"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pin:Ping_1426 ABC transporter for copper
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97825"
FT                   /db_xref="GOA:D6XWI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97825.1"
FT                   /translation="MKNMSIIAINQLSKSYGQVKALRDISLHVEEGDCIGFLGPNGAGK
FT                   TTAIRILLGLIKRTAGDVHVFGMDAWKDAVAIHRRLAYVPGDVHLWPNLTGGEVIDVFG
FT                   KLRGSVDRKRRDQLISRFDFDPTKKCGTYSKGNRQKVGLISAFASDVDLYILDEPTSGL
FT                   DPLMTQVFQECVEELKARGKTILMSSHILSDVERLCDDISMIRQGEIVESGKLSDLRHM
FT                   TRLHLKVETALETTGLSRVPGVSNVRREGRITAFEVDHDAMDPVLSQVITYQVKHLESR
FT                   PPSLEDLFMQHYGQREPVQEEGREVL"
     MKNMSIIAIN QLSKSYGQVK ALRDISLHVE EGDCIGFLGP NGAGKTTAIR ILLGLIKRTA        60
     GDVHVFGMDA WKDAVAIHRR LAYVPGDVHL WPNLTGGEVI DVFGKLRGSV DRKRRDQLIS       120
     RFDFDPTKKC GTYSKGNRQK VGLISAFASD VDLYILDEPT SGLDPLMTQV FQECVEELKA       180
     RGKTILMSSH ILSDVERLCD DISMIRQGEI VESGKLSDLR HMTRLHLKVE TALETTGLSR       240
     VPGVSNVRRE GRITAFEVDH DAMDPVLSQV ITYQVKHLES RPPSLEDLFM QHYGQREPVQ       300
     EEGREVL                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page