(data stored in ACNUC7421 zone)

EMBL: CP001791.PE275

CP001791.PE275       Location/Qualifiers
FT   CDS             300640..301545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0287"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dma:DMR_20610 GGDEF domain
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97827"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97827.1"
FT                   /translation="MEMKPEELDVLISQLTASEHLYGHIRVVDPVHKRVVYQNTGHGLE
FT                   PVSDLRACFELFDKKTACRNCISMRAYHENESFIKVETSPDRVHMVTAIPVEIAGRKVV
FT                   VEFFKDVTNSMIMDDASFNQGVEMKRLLDQANLAAVTDELTRVYNKRYILEKLPADLTL
FT                   ALAEQQPFGLIVADIDHFKSVNDTYGHLAGDQILREFAAVLKDTCLDQADWTARFGGEE
FT                   FVVCLPGKDRDTVLAVAERMRARIEEQVFHYDGQAITLTSSFGVYALAPGDVIDYETLL
FT                   KRADQHLYQSKRTGRNRVTG"
     MEMKPEELDV LISQLTASEH LYGHIRVVDP VHKRVVYQNT GHGLEPVSDL RACFELFDKK        60
     TACRNCISMR AYHENESFIK VETSPDRVHM VTAIPVEIAG RKVVVEFFKD VTNSMIMDDA       120
     SFNQGVEMKR LLDQANLAAV TDELTRVYNK RYILEKLPAD LTLALAEQQP FGLIVADIDH       180
     FKSVNDTYGH LAGDQILREF AAVLKDTCLD QADWTARFGG EEFVVCLPGK DRDTVLAVAE       240
     RMRARIEEQV FHYDGQAITL TSSFGVYALA PGDVIDYETL LKRADQHLYQ SKRTGRNRVT       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page