(data stored in ACNUC7421 zone)

EMBL: CP001791.PE277

CP001791.PE277       Location/Qualifiers
FT   CDS             complement(302991..304262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0289"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: dar:Daro_2372
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97829"
FT                   /db_xref="GOA:D6XWI7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADH97829.1"
FT                   /translation="MITYILKDMKLILRNRSELLLLFAMPLILIAILGFALRGMLTGGG
FT                   EGLSMDVALLDHDDPDAGEEALFTGFRESGMPEDMADEIQAGITGVSPAFLLNNLFDSD
FT                   ELDGMITIHEPPSRDAALMGLEDGTYNAVLEIPESFTYDSLNRMLTGEGEGGQLHLTVQ
FT                   DEQSIYGRVMHDILRRFTDSFNLETAIARETGAAPDEAPTEAGQVESITAYEPINSQQF
FT                   YTAGMAVMFVLFTAASIAAFANVERKSNVLDRILLSGTHAISYLSGKWLSAMLIAFLQL
FT                   IVLFVMAALMFQAFPQSSVSFWGGIALISLLTAMNVGALAALLTAISIRQKSDAAATVF
FT                   SGGVVAIMAFAGGSFFPAQALPGIVTTLGDMTPNGRAMSLYLRWIQGFELQELLPSIYV
FT                   LLLIAAVLTTAALVLYPKDREVKG"
     MITYILKDMK LILRNRSELL LLFAMPLILI AILGFALRGM LTGGGEGLSM DVALLDHDDP        60
     DAGEEALFTG FRESGMPEDM ADEIQAGITG VSPAFLLNNL FDSDELDGMI TIHEPPSRDA       120
     ALMGLEDGTY NAVLEIPESF TYDSLNRMLT GEGEGGQLHL TVQDEQSIYG RVMHDILRRF       180
     TDSFNLETAI ARETGAAPDE APTEAGQVES ITAYEPINSQ QFYTAGMAVM FVLFTAASIA       240
     AFANVERKSN VLDRILLSGT HAISYLSGKW LSAMLIAFLQ LIVLFVMAAL MFQAFPQSSV       300
     SFWGGIALIS LLTAMNVGAL AALLTAISIR QKSDAAATVF SGGVVAIMAF AGGSFFPAQA       360
     LPGIVTTLGD MTPNGRAMSL YLRWIQGFEL QELLPSIYVL LLIAAVLTTA ALVLYPKDRE       420
     VKG                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page