(data stored in ACNUC7421 zone)

EMBL: CP001791.PE278

CP001791.PE278       Location/Qualifiers
FT   CDS             complement(304275..305207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0290"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gem:GM21_0012 daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97830"
FT                   /db_xref="GOA:D6XWI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97830.1"
FT                   /translation="MLETHELTKTFKGITAVDQVNMYLGKGESVGLLGPNGAGKSTTIS
FT                   MISTLMKATTGHVLLNGQKIGSETRSIRSILGVVPQEIALYEDLSAYENLQFFGRIYGL
FT                   KGSDLKARIEDRLDLVGLTDRKHDLIKTYSGGMKRRINIACALLHDPEILIMDEPTVGI
FT                   DPQSRTYILDMVRQLNEEKGMTILYTSHYMEEVERLCDRIYIMDHGQIIANGTNDELKR
FT                   ILSNEEAIYIDIDAPNPVFTKQLSVIEGIRQVTDTDDGIKLIVDKGTRKLPDIFQLADA
FT                   LSVNVLNVRVEIPTLEDVFLHLTGRTLRD"
     MLETHELTKT FKGITAVDQV NMYLGKGESV GLLGPNGAGK STTISMISTL MKATTGHVLL        60
     NGQKIGSETR SIRSILGVVP QEIALYEDLS AYENLQFFGR IYGLKGSDLK ARIEDRLDLV       120
     GLTDRKHDLI KTYSGGMKRR INIACALLHD PEILIMDEPT VGIDPQSRTY ILDMVRQLNE       180
     EKGMTILYTS HYMEEVERLC DRIYIMDHGQ IIANGTNDEL KRILSNEEAI YIDIDAPNPV       240
     FTKQLSVIEG IRQVTDTDDG IKLIVDKGTR KLPDIFQLAD ALSVNVLNVR VEIPTLEDVF       300
     LHLTGRTLRD                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page