(data stored in ACNUC7421 zone)

EMBL: CP001791.PE279

CP001791.PE279       Location/Qualifiers
FT   CDS             complement(305316..305972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0291"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: sdn:Sden_3055 response regulator receiver;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97831"
FT                   /db_xref="GOA:D6XWI9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97831.1"
FT                   /translation="MTTQILLAEDQSLVRQGLKMMIETAPDLRVTAEANNGEEALRLLA
FT                   AKPAITLAILDIRMPVMNGLELAKAIQEHHPHVMTLMLTTFNDDDYAIEALRHGARGYL
FT                   LKDADPDALIRGIRTCLEGGLALEPHVAANVVPLLMNKPETKPEFPALPEDITERETTV
FT                   IACVGRGLSNKEISEELYLSVGTVKNLISVILHKLELRDRTQLAIYAIRSGFTER"
     MTTQILLAED QSLVRQGLKM MIETAPDLRV TAEANNGEEA LRLLAAKPAI TLAILDIRMP        60
     VMNGLELAKA IQEHHPHVMT LMLTTFNDDD YAIEALRHGA RGYLLKDADP DALIRGIRTC       120
     LEGGLALEPH VAANVVPLLM NKPETKPEFP ALPEDITERE TTVIACVGRG LSNKEISEEL       180
     YLSVGTVKNL ISVILHKLEL RDRTQLAIYA IRSGFTER                               218
//

If you have problems or comments...

PBIL Back to PBIL home page