(data stored in ACNUC7421 zone)

EMBL: CP001791.PE280

CP001791.PE280       Location/Qualifiers
FT   CDS             complement(305969..307162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0292"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: xcv:XCV0114 two-component
FT                   system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97832"
FT                   /db_xref="GOA:D6XWJ0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ0"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADH97832.1"
FT                   /translation="MRVSSKQTDTPEYEPVISQRLIHHQYWLWLGLLITAFGGYLILTP
FT                   VTSPVMMIRYIAAGLFFALFFLLPLTHSYRKLSGAAMALFLAVAAYPFEAPALYLFLIA
FT                   MIIYSGTVLYHLPRAGGLLLHTALFAAVSAGSWLTGGVEPLLITAVFGLLLIPVFILAF
FT                   GLIARYEALKEEHQSVISAYRATKRQLVADEERARHDERRTIARELHDSVGHKLTALLM
FT                   QLEVYRMSLPPAGQGDVDSLKELAKDSLSETRQAVKTLKHHEAAGLAAMIQLIRKLEAE
FT                   TMIHVQLTVRQGALTAPLSGDQAAAVYRAVQESLTNSMRHSGGREVSILFEVIGDTVFR
FT                   FHVSNPVTDDAPLKEGFGLTAMRERITACGGQLTISKEADRFAIDGRLPLMKEGDDA"
     MRVSSKQTDT PEYEPVISQR LIHHQYWLWL GLLITAFGGY LILTPVTSPV MMIRYIAAGL        60
     FFALFFLLPL THSYRKLSGA AMALFLAVAA YPFEAPALYL FLIAMIIYSG TVLYHLPRAG       120
     GLLLHTALFA AVSAGSWLTG GVEPLLITAV FGLLLIPVFI LAFGLIARYE ALKEEHQSVI       180
     SAYRATKRQL VADEERARHD ERRTIARELH DSVGHKLTAL LMQLEVYRMS LPPAGQGDVD       240
     SLKELAKDSL SETRQAVKTL KHHEAAGLAA MIQLIRKLEA ETMIHVQLTV RQGALTAPLS       300
     GDQAAAVYRA VQESLTNSMR HSGGREVSIL FEVIGDTVFR FHVSNPVTDD APLKEGFGLT       360
     AMRERITACG GQLTISKEAD RFAIDGRLPL MKEGDDA                                397
//

If you have problems or comments...

PBIL Back to PBIL home page