(data stored in ACNUC7421 zone)

EMBL: CP001791.PE282

CP001791.PE282       Location/Qualifiers
FT   CDS             complement(307810..308925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0294"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein; KEGG:
FT                   mei:Msip34_0729 histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97834"
FT                   /db_xref="GOA:D6XWJ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ2"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADH97834.1"
FT                   /translation="MTEKRRKWQIDGIVWDALRTQINAALAAFTVTLFLLLSLYQLGVN
FT                   PPGANGAYTLRFTDVALLLFVFAVIFLSFTAVFNYRQAARVKRGLVGMIYQLKQYQRSG
FT                   TYTPLSVTSKDELARLADELNGLTESVEERMVALRRMVNENSRLVKEAEQGASLEERRK
FT                   LARDLHDAVSQELFSVSMSLSAIPKLMEKDPDKARQLFERIEKMVHHTQQELRALIMHL
FT                   RPVTLEGKPLNLALSHLFDELTAKQPDMQFHCDLEDLPSLEKGVEEHVFRAIQEGISNA
FT                   LRHARASKLSLSVKRAKDLLLVTLSDDGDGFDLDSIDEERTGNVGLSAMKERMTEIGGN
FT                   FTCISIPQKGTRLEFRVPIIHTKEDTEDGED"
     MTEKRRKWQI DGIVWDALRT QINAALAAFT VTLFLLLSLY QLGVNPPGAN GAYTLRFTDV        60
     ALLLFVFAVI FLSFTAVFNY RQAARVKRGL VGMIYQLKQY QRSGTYTPLS VTSKDELARL       120
     ADELNGLTES VEERMVALRR MVNENSRLVK EAEQGASLEE RRKLARDLHD AVSQELFSVS       180
     MSLSAIPKLM EKDPDKARQL FERIEKMVHH TQQELRALIM HLRPVTLEGK PLNLALSHLF       240
     DELTAKQPDM QFHCDLEDLP SLEKGVEEHV FRAIQEGISN ALRHARASKL SLSVKRAKDL       300
     LLVTLSDDGD GFDLDSIDEE RTGNVGLSAM KERMTEIGGN FTCISIPQKG TRLEFRVPII       360
     HTKEDTEDGE D                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page