(data stored in ACNUC7421 zone)

EMBL: CP001791.PE283

CP001791.PE283       Location/Qualifiers
FT   CDS             complement(308918..309853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0295"
FT                   /product="Cell wall-active antibiotics response protein"
FT                   /note="PFAM: Cell wall-active antibiotics response protein;
FT                   KEGG: xcb:XC_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97835"
FT                   /db_xref="GOA:D6XWJ3"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ3"
FT                   /inference="protein motif:PFAM:PF09922"
FT                   /protein_id="ADH97835.1"
FT                   /translation="MKNLTALIIILLGTGFLLSNLGIIEGSFSNLIGTYWPAIVIWFGV
FT                   KWFFQGLAVFYHSLKRDRKNIGQIIWGFYVTVIGGVLLGNNTGYFDYTLSDVWNWTWPL
FT                   LIIYIGFKILFDREGDVVIHLGPDDVEKYSRKSKSPYHDEPEPLDDDAISAKAQKKAEK
FT                   AKRKAQAFADGKTGNYQKKSCGGYTTGAKRSLIGDFKLGNKPWEPDGKDLALGIGDVEI
FT                   DFTRAVLKPGLNEMRVDCWIGDISVLIPSHMPVRVEAEVKLGEVTLFNDSHAGTGRSAA
FT                   YTSPDFDTADEQLVILIQLSIGEIEVMTVD"
     MKNLTALIII LLGTGFLLSN LGIIEGSFSN LIGTYWPAIV IWFGVKWFFQ GLAVFYHSLK        60
     RDRKNIGQII WGFYVTVIGG VLLGNNTGYF DYTLSDVWNW TWPLLIIYIG FKILFDREGD       120
     VVIHLGPDDV EKYSRKSKSP YHDEPEPLDD DAISAKAQKK AEKAKRKAQA FADGKTGNYQ       180
     KKSCGGYTTG AKRSLIGDFK LGNKPWEPDG KDLALGIGDV EIDFTRAVLK PGLNEMRVDC       240
     WIGDISVLIP SHMPVRVEAE VKLGEVTLFN DSHAGTGRSA AYTSPDFDTA DEQLVILIQL       300
     SIGEIEVMTV D                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page