(data stored in ACNUC7421 zone)

EMBL: CP001791.PE286

CP001791.PE286       Location/Qualifiers
FT   CDS             311788..312165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97838"
FT                   /db_xref="InterPro:IPR021598"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97838.1"
FT                   /translation="MIGMKQIVMLTALMFLGACGTEETGGAPDEDQGMEYGLIGEVIEL
FT                   ERHERDDQLGSIRVQGNHEDAMYDDGVVTITTDTAFDPDAFGGFEALETGMEVEVVFDG
FT                   AAMESHPVQATAAQINVLDQE"
     MIGMKQIVML TALMFLGACG TEETGGAPDE DQGMEYGLIG EVIELERHER DDQLGSIRVQ        60
     GNHEDAMYDD GVVTITTDTA FDPDAFGGFE ALETGMEVEV VFDGAAMESH PVQATAAQIN       120
     VLDQE                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page