(data stored in ACNUC7421 zone)

EMBL: CP001791.PE289

CP001791.PE289       Location/Qualifiers
FT   CDS             complement(313547..314089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0301"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: hch:HCH_05422 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97841"
FT                   /db_xref="GOA:D6XWJ9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ9"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADH97841.1"
FT                   /translation="MPQTRNVTLFIAMSLDGCIATSDHSLDWLEQVEGEGDNGYEKFYS
FT                   TVDTVLLGRKTYDWIRQLALPAFPYEGKSAFVFSRDHHPENDDVHWINEDPVSFVRSLK
FT                   ASDGGTIWLVGGGELVKTLYEAGLIDSYIITIAPVLLGNGIPLFLTNSRHQELELLNSE
FT                   RYGQFIQLYYKRKTRPD"
     MPQTRNVTLF IAMSLDGCIA TSDHSLDWLE QVEGEGDNGY EKFYSTVDTV LLGRKTYDWI        60
     RQLALPAFPY EGKSAFVFSR DHHPENDDVH WINEDPVSFV RSLKASDGGT IWLVGGGELV       120
     KTLYEAGLID SYIITIAPVL LGNGIPLFLT NSRHQELELL NSERYGQFIQ LYYKRKTRPD       180
//

If you have problems or comments...

PBIL Back to PBIL home page