(data stored in ACNUC7421 zone)

EMBL: CP001791.PE29

CP001791.PE29        Location/Qualifiers
FT   CDS             42164..42646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97581"
FT                   /db_xref="GOA:D6XV23"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97581.1"
FT                   /translation="MTVNRFFNRHGKKLLILVYVLFLFSVPAFVDMVHSVLYLIAVAIL
FT                   SFIVIRRELAPEASERAFMAKWIEKRKRSVHVNGLINAGLTFVTMAASIFIVPFIVDGR
FT                   LMEWSALSAGQWTVIVLFLAVFSLAPGYVSVWEREKRYDKLVVKHERMRKHAEGDG"
     MTVNRFFNRH GKKLLILVYV LFLFSVPAFV DMVHSVLYLI AVAILSFIVI RRELAPEASE        60
     RAFMAKWIEK RKRSVHVNGL INAGLTFVTM AASIFIVPFI VDGRLMEWSA LSAGQWTVIV       120
     LFLAVFSLAP GYVSVWEREK RYDKLVVKHE RMRKHAEGDG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page