(data stored in ACNUC7421 zone)

EMBL: CP001791.PE291

CP001791.PE291       Location/Qualifiers
FT   CDS             complement(314638..316530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0303"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: cla:Cla_0048 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97843"
FT                   /db_xref="GOA:D6XWK1"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK1"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADH97843.1"
FT                   /translation="MTDLYTSAKAPHQDTHHDPIMTELNRVTRSKDPAVTRENANVDST
FT                   SPSGMMNRFASIAARAYAREHLLSDETLRAIDDNLIHIHDLDYYVTGTTTCCQIPLGKL
FT                   LATGFDTGHGFIRPPQSITTALSLAAIIFQSNQNQQHGGQSYQAFDHDLAPYVTKTNER
FT                   HLNRLRDERPDLTEDERKARAWQQTDRDVYQACEAFIHNLNSLHSRSGGQVPFTSINYG
FT                   TDTSKAGRLLIRNLLHATLRGLGNGETPIFPIQIMKLKAGVNLKPGDPNEDLYQLALKT
FT                   TGKRLFPNFSFLDAPFNASALDEARPETEVAYMGCRTRVMQNRHGDDQSVGRGNLSFTS
FT                   INLVRLALTSPDTTAFFHRLDNTVHLVIRQLLERFRYQCSQPPASFSFLFGEELWHTSG
FT                   TLKNGACLADVLKHGTLSIGFIGLAEALVALTGSHHGEGDKAEALGLSIVRRLRTLCDE
FT                   ASDTHDMNITLIGTPAEGLSGRFVKHDQKQFGTIPGVTDRAYYTNSFHVPVYAQTTIAE
FT                   KIRIEAPYHAFTNAGHISYIEVDGDVSGNLKAMDQIVQHMARSGMGYGSINHPVDRCLT
FT                   CSHTGPIDTECPSCGNDNPDQIERIRRITGYLVGSMSRWNPAKTAEEEDRVKHR"
     MTDLYTSAKA PHQDTHHDPI MTELNRVTRS KDPAVTRENA NVDSTSPSGM MNRFASIAAR        60
     AYAREHLLSD ETLRAIDDNL IHIHDLDYYV TGTTTCCQIP LGKLLATGFD TGHGFIRPPQ       120
     SITTALSLAA IIFQSNQNQQ HGGQSYQAFD HDLAPYVTKT NERHLNRLRD ERPDLTEDER       180
     KARAWQQTDR DVYQACEAFI HNLNSLHSRS GGQVPFTSIN YGTDTSKAGR LLIRNLLHAT       240
     LRGLGNGETP IFPIQIMKLK AGVNLKPGDP NEDLYQLALK TTGKRLFPNF SFLDAPFNAS       300
     ALDEARPETE VAYMGCRTRV MQNRHGDDQS VGRGNLSFTS INLVRLALTS PDTTAFFHRL       360
     DNTVHLVIRQ LLERFRYQCS QPPASFSFLF GEELWHTSGT LKNGACLADV LKHGTLSIGF       420
     IGLAEALVAL TGSHHGEGDK AEALGLSIVR RLRTLCDEAS DTHDMNITLI GTPAEGLSGR       480
     FVKHDQKQFG TIPGVTDRAY YTNSFHVPVY AQTTIAEKIR IEAPYHAFTN AGHISYIEVD       540
     GDVSGNLKAM DQIVQHMARS GMGYGSINHP VDRCLTCSHT GPIDTECPSC GNDNPDQIER       600
     IRRITGYLVG SMSRWNPAKT AEEEDRVKHR                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page