(data stored in ACNUC7421 zone)

EMBL: CP001791.PE293

CP001791.PE293       Location/Qualifiers
FT   CDS             complement(317003..318046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0305"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: smt:Smal_2295 ribonucleotide-diphosphate
FT                   reductase subunit beta; PFAM: ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97845"
FT                   /db_xref="GOA:D6XWK3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK3"
FT                   /inference="protein motif:PRIAM:1.17.4.1"
FT                   /protein_id="ADH97845.1"
FT                   /translation="MIHEPMIRIPLLNPTHPNRSTGLIQGEASGILNWNDIAYPHMYDL
FT                   YQTLLANFWKAQEINMQDDIKQWAELTPAEQDVFLRINTQLASLDSLQTPTMSQVMDYV
FT                   TDPSFKAIFAIVAQQEAVHNESYSYVLSSLVNQQEQTRRFQEAKEDPLIQRRNDVILSA
FT                   YERFRQHPSPQHLFELAVQSLNLEGVYFYAGFAFFYHLARQQKMMKTSTMISYIQRDEM
FT                   QHAYFMSQFVRILLTDHPELNTRENVQYVYDAMASAAGLEQEWAAVILADIDGIDLGEF
FT                   NGYVEYLVNKRLRQLGLSNLFPERDNPMPWIHVFSDTMMNQTKSDFFEQKSRSYTKVTS
FT                   DNGFDEL"
     MIHEPMIRIP LLNPTHPNRS TGLIQGEASG ILNWNDIAYP HMYDLYQTLL ANFWKAQEIN        60
     MQDDIKQWAE LTPAEQDVFL RINTQLASLD SLQTPTMSQV MDYVTDPSFK AIFAIVAQQE       120
     AVHNESYSYV LSSLVNQQEQ TRRFQEAKED PLIQRRNDVI LSAYERFRQH PSPQHLFELA       180
     VQSLNLEGVY FYAGFAFFYH LARQQKMMKT STMISYIQRD EMQHAYFMSQ FVRILLTDHP       240
     ELNTRENVQY VYDAMASAAG LEQEWAAVIL ADIDGIDLGE FNGYVEYLVN KRLRQLGLSN       300
     LFPERDNPMP WIHVFSDTMM NQTKSDFFEQ KSRSYTKVTS DNGFDEL                     347
//

If you have problems or comments...

PBIL Back to PBIL home page