(data stored in ACNUC7421 zone)

EMBL: CP001791.PE295

CP001791.PE295       Location/Qualifiers
FT   CDS             complement(320864..320971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97847"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97847.1"
FT                   /translation="MHPFISNMLMIAVTFALALLFFTVYVGIPIGRFTF"
     MHPFISNMLM IAVTFALALL FFTVYVGIPI GRFTF                                   35
//

If you have problems or comments...

PBIL Back to PBIL home page