(data stored in ACNUC7421 zone)

EMBL: CP001791.PE298

CP001791.PE298       Location/Qualifiers
FT   CDS             322966..323160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97850"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97850.1"
FT                   /translation="MILLKSLFLVGTGDVLSFSHLHHPSEEEQFFLSEETTTQYITGVC
FT                   YKPPLQTDREVVKWWVVDA"
     MILLKSLFLV GTGDVLSFSH LHHPSEEEQF FLSEETTTQY ITGVCYKPPL QTDREVVKWW        60
     VVDA                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page