(data stored in ACNUC7421 zone)

EMBL: CP001791.PE30

CP001791.PE30        Location/Qualifiers
FT   CDS             complement(42673..43281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97582"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97582.1"
FT                   /translation="MLRSLFVSLPAAFLITLSACGTEADQNRGNEQPERDIDHVSGEAA
FT                   HMERGQETNNGAERNDETAPVSFTEQEAISLLHDYEETLQAFFEEAQAHGQTLESVGEI
FT                   GEVENELTRILSAEGADMHLNTYFREEDGTVTVIPTEAPVWFDETAPYTFYDNEQGSPR
FT                   LEQERENELIGHVRMIYSFSYDDRQETWRISDIDSEPMS"
     MLRSLFVSLP AAFLITLSAC GTEADQNRGN EQPERDIDHV SGEAAHMERG QETNNGAERN        60
     DETAPVSFTE QEAISLLHDY EETLQAFFEE AQAHGQTLES VGEIGEVENE LTRILSAEGA       120
     DMHLNTYFRE EDGTVTVIPT EAPVWFDETA PYTFYDNEQG SPRLEQEREN ELIGHVRMIY       180
     SFSYDDRQET WRISDIDSEP MS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page