(data stored in ACNUC7421 zone)

EMBL: CP001791.PE306

CP001791.PE306       Location/Qualifiers
FT   CDS             327524..328210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0318"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: dal:Dalk_0879 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97858"
FT                   /db_xref="GOA:D6XWL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97858.1"
FT                   /translation="MATILIVDDETRMLDLVALYVAPYGHRVLKESDGEAAVNRVADEP
FT                   VDLVILDVMMPKMNGWEVCQDIRSFSDVPIIMLTARDGKEDVVKGLRYGADDYVTKPFD
FT                   EGELMARVDALLRRTKRQDEAACGGLVWNGRERALSFEGEAIHLTPKEFDTIGLFLRNP
FT                   GRAFSREEIIETAWGLGSGTEGRTVDTHIRNMREKIKKSGFPVEDHLKTVWGKGYKWES
FT                   ERDGSH"
     MATILIVDDE TRMLDLVALY VAPYGHRVLK ESDGEAAVNR VADEPVDLVI LDVMMPKMNG        60
     WEVCQDIRSF SDVPIIMLTA RDGKEDVVKG LRYGADDYVT KPFDEGELMA RVDALLRRTK       120
     RQDEAACGGL VWNGRERALS FEGEAIHLTP KEFDTIGLFL RNPGRAFSRE EIIETAWGLG       180
     SGTEGRTVDT HIRNMREKIK KSGFPVEDHL KTVWGKGYKW ESERDGSH                    228
//

If you have problems or comments...

PBIL Back to PBIL home page