(data stored in ACNUC7421 zone)

EMBL: CP001791.PE307

CP001791.PE307       Location/Qualifiers
FT   CDS             328321..328821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0319"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: afw:Anae109_0489 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97859"
FT                   /db_xref="GOA:D6XWL7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL7"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97859.1"
FT                   /translation="MSDIETLFEDHADDVYHFLVYYTRRDDVEDLVQETFIRALRSIDG
FT                   FEGRSAAKTWLITIARRLTVDGGRKKRDVPVGDEHLEYRQNETGTDASEAVIRQETADE
FT                   LLDQIHRLPDRQRDVMLLRGISELDATETAAVLNMSRTGVYVTYHRALRTLRSRMDRGG
FT                   DRL"
     MSDIETLFED HADDVYHFLV YYTRRDDVED LVQETFIRAL RSIDGFEGRS AAKTWLITIA        60
     RRLTVDGGRK KRDVPVGDEH LEYRQNETGT DASEAVIRQE TADELLDQIH RLPDRQRDVM       120
     LLRGISELDA TETAAVLNMS RTGVYVTYHR ALRTLRSRMD RGGDRL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page