(data stored in ACNUC7421 zone)

EMBL: CP001791.PE308

CP001791.PE308       Location/Qualifiers
FT   CDS             328818..329744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97860"
FT                   /db_xref="GOA:D6XWL8"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97860.1"
FT                   /translation="MKRDPVIEELKNKPKRRLSGVSRRGILHELKQEEARLDAKSTRRK
FT                   GRWLPPGKGMTYAATVLLFPVIAVVMWLLLEGSSDMEETMFFQGEQVNITAPKEPDETA
FT                   LVFHFEQHEAGDVILDGSPDPDVARRIAANHEIDGIERFGRIEGAKYDFYGYYYVDDHR
FT                   RLHLAGAVTIDSGAEDEQYLLEVFSIQIDESTLRAFHDGEENMMTMLNDARHGQSEQYY
FT                   LFGLGFSPEANVADVTVEGFDELETLIADGQLIMFGFGDTLERHLDVVVDGAGLDMFID
FT                   RLETELCLEDGSCYERPFLRHPLLPDY"
     MKRDPVIEEL KNKPKRRLSG VSRRGILHEL KQEEARLDAK STRRKGRWLP PGKGMTYAAT        60
     VLLFPVIAVV MWLLLEGSSD MEETMFFQGE QVNITAPKEP DETALVFHFE QHEAGDVILD       120
     GSPDPDVARR IAANHEIDGI ERFGRIEGAK YDFYGYYYVD DHRRLHLAGA VTIDSGAEDE       180
     QYLLEVFSIQ IDESTLRAFH DGEENMMTML NDARHGQSEQ YYLFGLGFSP EANVADVTVE       240
     GFDELETLIA DGQLIMFGFG DTLERHLDVV VDGAGLDMFI DRLETELCLE DGSCYERPFL       300
     RHPLLPDY                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page