(data stored in ACNUC7421 zone)

EMBL: CP001791.PE309

CP001791.PE309       Location/Qualifiers
FT   CDS             330092..331120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0321"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: asu:Asuc_1193 DNA-binding transcriptional
FT                   repressor PurR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97861"
FT                   /db_xref="GOA:D6XWL9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL9"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH97861.1"
FT                   /translation="MKMTIKEIAKLAGVSQATVSKIINNYDDVGQKTKERVLAIMDEYG
FT                   YRPSYAAQSLVKKVTKVVGVIYAGHINANFNHPFFVEVVDMFKKTLGGEGYDLLFFSNE
FT                   KFHKADENYLQRCQHYNVDGCIIIGGEQVEPSIYELDQSTIPCIGVDIELTGPHSGYIM
FT                   TDNIQVSSMAVEHFYLTGRREVAFIGGEKESFVSRQREAGFRERIKAYGLQAPEEWFVY
FT                   GDFFEESGYACMKELLRSERTPQAIFAISDLMAFGAMKAIKDQGLDIHDFAIIGCDDIT
FT                   AAKHVEPPLTTIKQDKQKIGRMAAFILKDLITGHIEQTSLKVDPELVVRESCGSKKPGV
FT                   MR"
     MKMTIKEIAK LAGVSQATVS KIINNYDDVG QKTKERVLAI MDEYGYRPSY AAQSLVKKVT        60
     KVVGVIYAGH INANFNHPFF VEVVDMFKKT LGGEGYDLLF FSNEKFHKAD ENYLQRCQHY       120
     NVDGCIIIGG EQVEPSIYEL DQSTIPCIGV DIELTGPHSG YIMTDNIQVS SMAVEHFYLT       180
     GRREVAFIGG EKESFVSRQR EAGFRERIKA YGLQAPEEWF VYGDFFEESG YACMKELLRS       240
     ERTPQAIFAI SDLMAFGAMK AIKDQGLDIH DFAIIGCDDI TAAKHVEPPL TTIKQDKQKI       300
     GRMAAFILKD LITGHIEQTS LKVDPELVVR ESCGSKKPGV MR                          342
//

If you have problems or comments...

PBIL Back to PBIL home page