(data stored in ACNUC7421 zone)

EMBL: CP001791.PE310

CP001791.PE310       Location/Qualifiers
FT   CDS             331117..331737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0322"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97862"
FT                   /db_xref="GOA:D6XWM0"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM0"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97862.1"
FT                   /translation="MNKIQQLSEGIFRYALLNLMWVGYSLLGFIVFGILPATIALFKVH
FT                   FHQHRNRLEPERESDVRVFHEAYKSSFIRGNLLMLILTAAGVFLYADLYIVLRMDHALM
FT                   PILLGLIVALTVLYLLFLFFVPASFAYENRPFFETIRAGFYMAVLSPIYSISLVIAFGI
FT                   IIYAGQIVPAIHLFFTASVMTYLVTAVFLLKADRLRRMAGKNN"
     MNKIQQLSEG IFRYALLNLM WVGYSLLGFI VFGILPATIA LFKVHFHQHR NRLEPERESD        60
     VRVFHEAYKS SFIRGNLLML ILTAAGVFLY ADLYIVLRMD HALMPILLGL IVALTVLYLL       120
     FLFFVPASFA YENRPFFETI RAGFYMAVLS PIYSISLVIA FGIIIYAGQI VPAIHLFFTA       180
     SVMTYLVTAV FLLKADRLRR MAGKNN                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page