(data stored in ACNUC7421 zone)

EMBL: CP001791.PE313

CP001791.PE313       Location/Qualifiers
FT   CDS             334440..335279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0325"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_1101
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97865"
FT                   /db_xref="GOA:D6XWM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97865.1"
FT                   /translation="MKSEKQKTLISKILLYIGLSIVSLASLFPFYWMFVMATNSNEMIN
FT                   RTPPVMVPGDRLVDNFQNVLNSIPFFQTMLNSLIAATSITLGVLLLTSIAGFAFAKLEF
FT                   PARNILFFFILGTMMIPPQLGLIPTYFIITELGWLSDLRAVIVPGLMNAFGIFWMRQYV
FT                   ASAVPDEIIEAARIDGCSNFRIYWNIVVPVILPAFATLGIIVFMFVWGDYLWPLVVLQD
FT                   QSSQTIQVALRSLMDDRSRDYGMILSGTFWATVPLVVVFLFFNKLFIRSIADGAVKS"
     MKSEKQKTLI SKILLYIGLS IVSLASLFPF YWMFVMATNS NEMINRTPPV MVPGDRLVDN        60
     FQNVLNSIPF FQTMLNSLIA ATSITLGVLL LTSIAGFAFA KLEFPARNIL FFFILGTMMI       120
     PPQLGLIPTY FIITELGWLS DLRAVIVPGL MNAFGIFWMR QYVASAVPDE IIEAARIDGC       180
     SNFRIYWNIV VPVILPAFAT LGIIVFMFVW GDYLWPLVVL QDQSSQTIQV ALRSLMDDRS       240
     RDYGMILSGT FWATVPLVVV FLFFNKLFIR SIADGAVKS                              279
//

If you have problems or comments...

PBIL Back to PBIL home page