(data stored in ACNUC7421 zone)

EMBL: CP001791.PE314

CP001791.PE314       Location/Qualifiers
FT   CDS             335429..338569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97866"
FT                   /db_xref="GOA:D6XWM4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM4"
FT                   /inference="similar to AA sequence:KEGG:PHATRDRAFT_54686"
FT                   /protein_id="ADH97866.1"
FT                   /translation="MNQLNNDGSFQMDDFQNKAPFSSFLPGIAGARGIPAWAFYVNRGQ
FT                   GIASFGVQDKDHAIMEFHPADKSYQHVYQQGFRTFLNVHDEDGDVFVEPFAIEGAVSEQ
FT                   VKESMQIHDNALKLTYSHETVGLEMTVTYTALPESKVGALMRHVDLTNKTDRPVHVELL
FT                   DGMPRVMPSGVSNAAYKELGNTLKSWFDVEEASWSVPFYTLRGSMDDSAEVREIPAGNF
FT                   YSTLVKTETGIHQPVPVVDPGLVFGTDTSLTLPKGFLGGFQAPETIEEQTVTNKVACGF
FT                   THLDISLEPGSSVSWISVTGSGKNKETVAGFISETFNFDELLAKEARAMALVKEMTDTV
FT                   SAKTAHPVFDSYARQNYLDNGLRGGFPVAYGSEPGQIFYLFSRKHGDLERDYNFFSISP
FT                   TYYSQGNGNYRDVNQNRRLDLFFEPRVHDRSVRQFMSLIQLDGYNPLVVKGTTFSAGET
FT                   VDGVITNHVGADDREKVLTFFDTPFTPGELLHFVEDEGIMLMASFEEFLESVLKESLES
FT                   VDADHGEGFWVDHWTYNLDLIDSFLGVYPDQREQFFTDKVYPFFDTPVSIMPRSSTYRI
FT                   LEGKGLRQYDAIKEDEEKLHGQKDGEISSWVARKEGGRYETDLYSKLVLLAASKTAAIA
FT                   PYGLGVEMEAGKPGWNDSLNGLPGLVGTSTSELMELKRLVDLLVDEGPYDVTLPSPSVA
FT                   FIHQLADLAGEPSGDAMTDWDQRATLRETYRSQVTGKPVQSETVVDQATVKERLIALKR
FT                   LVDESVEAVNGYGELIPTYFYFEAEGELHEDLSKLQLKPVAVTPFLEGIVKKMKVSDRS
FT                   GAKALYDKVKDSDIYDRKLGMYKTSMSIQGETNEIGRAKAFTPGWLENESIFLHMAYKY
FT                   HLETLRSGLYTDYYEDIKHALIPFLDADVYGRSTLENSSFIASSANPDESLHGRGYVAR
FT                   LSGSTVEFLHMWLVMMGAERPFTAEDGLTFALSPKLAGSFFTEEGEVSFRLFNQCEVTY
FT                   SNPSRKDTFGENAVKPVQYTLTYRDGKEELLNAGDVTGPSAEAVRNGSVSAIHVTLA"
     MNQLNNDGSF QMDDFQNKAP FSSFLPGIAG ARGIPAWAFY VNRGQGIASF GVQDKDHAIM        60
     EFHPADKSYQ HVYQQGFRTF LNVHDEDGDV FVEPFAIEGA VSEQVKESMQ IHDNALKLTY       120
     SHETVGLEMT VTYTALPESK VGALMRHVDL TNKTDRPVHV ELLDGMPRVM PSGVSNAAYK       180
     ELGNTLKSWF DVEEASWSVP FYTLRGSMDD SAEVREIPAG NFYSTLVKTE TGIHQPVPVV       240
     DPGLVFGTDT SLTLPKGFLG GFQAPETIEE QTVTNKVACG FTHLDISLEP GSSVSWISVT       300
     GSGKNKETVA GFISETFNFD ELLAKEARAM ALVKEMTDTV SAKTAHPVFD SYARQNYLDN       360
     GLRGGFPVAY GSEPGQIFYL FSRKHGDLER DYNFFSISPT YYSQGNGNYR DVNQNRRLDL       420
     FFEPRVHDRS VRQFMSLIQL DGYNPLVVKG TTFSAGETVD GVITNHVGAD DREKVLTFFD       480
     TPFTPGELLH FVEDEGIMLM ASFEEFLESV LKESLESVDA DHGEGFWVDH WTYNLDLIDS       540
     FLGVYPDQRE QFFTDKVYPF FDTPVSIMPR SSTYRILEGK GLRQYDAIKE DEEKLHGQKD       600
     GEISSWVARK EGGRYETDLY SKLVLLAASK TAAIAPYGLG VEMEAGKPGW NDSLNGLPGL       660
     VGTSTSELME LKRLVDLLVD EGPYDVTLPS PSVAFIHQLA DLAGEPSGDA MTDWDQRATL       720
     RETYRSQVTG KPVQSETVVD QATVKERLIA LKRLVDESVE AVNGYGELIP TYFYFEAEGE       780
     LHEDLSKLQL KPVAVTPFLE GIVKKMKVSD RSGAKALYDK VKDSDIYDRK LGMYKTSMSI       840
     QGETNEIGRA KAFTPGWLEN ESIFLHMAYK YHLETLRSGL YTDYYEDIKH ALIPFLDADV       900
     YGRSTLENSS FIASSANPDE SLHGRGYVAR LSGSTVEFLH MWLVMMGAER PFTAEDGLTF       960
     ALSPKLAGSF FTEEGEVSFR LFNQCEVTYS NPSRKDTFGE NAVKPVQYTL TYRDGKEELL      1020
     NAGDVTGPSA EAVRNGSVSA IHVTLA                                           1046
//

If you have problems or comments...

PBIL Back to PBIL home page