(data stored in ACNUC7421 zone)

EMBL: CP001791.PE315

CP001791.PE315       Location/Qualifiers
FT   CDS             338726..339541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0327"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rlt:Rleg2_6440 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97867"
FT                   /db_xref="GOA:D6XWM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97867.1"
FT                   /translation="MDPFEQYYIQIEGREDATHTLVFAHGFGCDQQVWNLVSPAFEDEY
FT                   LIVRFDYTGAGRSAKSAYSSEKYRTLDGYAEDLKAVIHAAGGERITVVAHSVSGMIAAQ
FT                   AIIDEPGLFDDLIMIGPSAHYLNHPDYHGGFDREDIDGLLHMMEQNYKEWARYLAPIVM
FT                   KNEDRPELAEDFSNQLCSNDAAIIREFAEATFLSDHRDILEAVNVPVLVIQPADDTIVP
FT                   VEATTYLVRELPDARIVWMNGRGHNPHLSHPEELIPLIEEWTGRDGVRE"
     MDPFEQYYIQ IEGREDATHT LVFAHGFGCD QQVWNLVSPA FEDEYLIVRF DYTGAGRSAK        60
     SAYSSEKYRT LDGYAEDLKA VIHAAGGERI TVVAHSVSGM IAAQAIIDEP GLFDDLIMIG       120
     PSAHYLNHPD YHGGFDREDI DGLLHMMEQN YKEWARYLAP IVMKNEDRPE LAEDFSNQLC       180
     SNDAAIIREF AEATFLSDHR DILEAVNVPV LVIQPADDTI VPVEATTYLV RELPDARIVW       240
     MNGRGHNPHL SHPEELIPLI EEWTGRDGVR E                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page