(data stored in ACNUC7421 zone)

EMBL: CP001791.PE316

CP001791.PE316       Location/Qualifiers
FT   CDS             339538..340506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0328"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tdn:Suden_1036 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97868"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97868.1"
FT                   /translation="MNEQLNRAPCGYFVMNDAFRMIEANESFASLVKREHFELLDLNFQ
FT                   QLLTVASRVYFQTYFEPIMNIQGKVRELYLTLKVDGKSLPVLMSANAYGNTYECVVMEM
FT                   SVRSEYETEMITARKNAEKVLQDTDEAYTSLLGVMNEHEQRKQELIRLNAELNELAITD
FT                   NLTHLKNRRFFEDRLSYLLDLYEKEGVPFSICLIDVDEFKRFNDTFGHLAGDFVLKELA
FT                   KIMESHIRNDDLVSRFGGEEFIILLPSVGVDVAIDVIERLRMAVEDHDWIDRQVTISCG
FT                   LTECIIGDDHESILRRVDDALYRSKENGRNRVTLHRDDEQP"
     MNEQLNRAPC GYFVMNDAFR MIEANESFAS LVKREHFELL DLNFQQLLTV ASRVYFQTYF        60
     EPIMNIQGKV RELYLTLKVD GKSLPVLMSA NAYGNTYECV VMEMSVRSEY ETEMITARKN       120
     AEKVLQDTDE AYTSLLGVMN EHEQRKQELI RLNAELNELA ITDNLTHLKN RRFFEDRLSY       180
     LLDLYEKEGV PFSICLIDVD EFKRFNDTFG HLAGDFVLKE LAKIMESHIR NDDLVSRFGG       240
     EEFIILLPSV GVDVAIDVIE RLRMAVEDHD WIDRQVTISC GLTECIIGDD HESILRRVDD       300
     ALYRSKENGR NRVTLHRDDE QP                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page