(data stored in ACNUC7421 zone)

EMBL: CP001791.PE317

CP001791.PE317       Location/Qualifiers
FT   CDS             complement(340584..342737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:342660..342662,aa:Sec)
FT                   /locus_tag="Bsel_0329"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: gsu:GSU2147 cadmium-translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; Contains
FT                   selenocysteine; PFAM: E1-E2 ATPase-associated domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97869"
FT                   /db_xref="GOA:D6XWM7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM7"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADH97869.1"
FT                   /translation="MGERKLDDQQSVADSTATYRIDGLSUADCAKTFESNVKRLDGVED
FT                   ANLNFGAAKITVSGHTTIKELEKAGAFEGLKLRPERASSSKQVSFWKLPTTRKVYVATL
FT                   LLLVALAATVQYGESHPVTGIAYLATVITGGYSLFNKGFRNLIRLNFDMNTLMTIAVTG
FT                   AAIIGEWMEGAIVVILFAISEALERYSMDKARQSIASLMDIAPNEALIRRNGEERMLLV
FT                   EDIQVGDIMIVKPGEKLAMDGRVVSGTSSINQAAITGESVPVMKDSGDDVFAGTLNEEG
FT                   LLEIEVTRLVEDTTLAKIIHLVEEAQNEQAPSQQFVDRFAYYYTPAIIVLAALVMTVPP
FT                   LVTGAPWETWIYLGLATLVVGCPCALVISTPVAVVTAIGNAARNGVLIKGGIHLEEAGG
FT                   LKAMAFDKTGTLTKGTPVVTDVIPFAYGKEEALHLAAAVEDGSKHPLATAIIRAAEASG
FT                   FDRSAYVMSGFRSLTSLGVEASVNGETILTGSPRVFQDRGLLHDERIQETIASLEASGK
FT                   TVMAVGHSTALIALIAVADEVRETAKSVIKDLNRMAIETVMLTGDNERTANAIAHDTGV
FT                   TRVYAGLMPEDKLDRIRNLRHSHGHVAMVGDGVNDAPALAASNLGVAMGGAGTDTALET
FT                   ADIALMADDLNKLPFTIRLSQKALSIIKQNITFALGLKALALLLVIPGWLTLWIAIIAD
FT                   MGATLLVTANSLRLMRMKEKVYK"
     MGERKLDDQQ SVADSTATYR IDGLSXADCA KTFESNVKRL DGVEDANLNF GAAKITVSGH        60
     TTIKELEKAG AFEGLKLRPE RASSSKQVSF WKLPTTRKVY VATLLLLVAL AATVQYGESH       120
     PVTGIAYLAT VITGGYSLFN KGFRNLIRLN FDMNTLMTIA VTGAAIIGEW MEGAIVVILF       180
     AISEALERYS MDKARQSIAS LMDIAPNEAL IRRNGEERML LVEDIQVGDI MIVKPGEKLA       240
     MDGRVVSGTS SINQAAITGE SVPVMKDSGD DVFAGTLNEE GLLEIEVTRL VEDTTLAKII       300
     HLVEEAQNEQ APSQQFVDRF AYYYTPAIIV LAALVMTVPP LVTGAPWETW IYLGLATLVV       360
     GCPCALVIST PVAVVTAIGN AARNGVLIKG GIHLEEAGGL KAMAFDKTGT LTKGTPVVTD       420
     VIPFAYGKEE ALHLAAAVED GSKHPLATAI IRAAEASGFD RSAYVMSGFR SLTSLGVEAS       480
     VNGETILTGS PRVFQDRGLL HDERIQETIA SLEASGKTVM AVGHSTALIA LIAVADEVRE       540
     TAKSVIKDLN RMAIETVMLT GDNERTANAI AHDTGVTRVY AGLMPEDKLD RIRNLRHSHG       600
     HVAMVGDGVN DAPALAASNL GVAMGGAGTD TALETADIAL MADDLNKLPF TIRLSQKALS       660
     IIKQNITFAL GLKALALLLV IPGWLTLWIA IIADMGATLL VTANSLRLMR MKEKVYK          717
//

If you have problems or comments...

PBIL Back to PBIL home page