(data stored in ACNUC7421 zone)

EMBL: CP001791.PE318

CP001791.PE318       Location/Qualifiers
FT   CDS             complement(342740..343102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0330"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: dde:Dde_0747 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97870"
FT                   /db_xref="GOA:D6XWM8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADH97870.1"
FT                   /translation="MKTTDTCDIFTYDSERVESTSAMIQNRDLDGAARIFKVLGDRNRT
FT                   AITYALCENDTLCVCDIATIIDASVATTSHHLRTLYKEGVVTYEKKGKLAMYALDDNHI
FT                   RQLMMTTLEHAEERKD"
     MKTTDTCDIF TYDSERVEST SAMIQNRDLD GAARIFKVLG DRNRTAITYA LCENDTLCVC        60
     DIATIIDASV ATTSHHLRTL YKEGVVTYEK KGKLAMYALD DNHIRQLMMT TLEHAEERKD       120
//

If you have problems or comments...

PBIL Back to PBIL home page