(data stored in ACNUC7421 zone)

EMBL: CP001791.PE319

CP001791.PE319       Location/Qualifiers
FT   CDS             complement(343321..344370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0331"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: shw:Sputw3181_3443 sulfate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97871"
FT                   /db_xref="GOA:D6XWM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97871.1"
FT                   /translation="MLDVAIQKSYPDFTLDIAFQAKPGLTGILGPSGCGKSLTLQALAG
FT                   ILKPDNGSIRMDGQTWFDSERRIHVKPRDRKTGYVFQSYALFPHLTVAENIAYGLKGLP
FT                   KTEIREKVANWLDLIKLKGFGQRYPSQLSGGQKQRVALARSMITEPKLLLLDEPFSALD
FT                   EHIKRQLEEDMLRLLGEHYNGIALLVTHNIEEAYRLGEDGMLFHEGRVLQQGPRDEVLR
FT                   SPSSIPAAEIIGTENIFSAPAPLTVKEEHIQIGNARFPLPPSSDSDTVHGMAVHAHDIR
FT                   LASQEEDSGGPHHYQGELIRTIPGVRQAMLIVNIGGVHWRLSAQESRGLKAGDTLTVSI
FT                   PPKAIHILR"
     MLDVAIQKSY PDFTLDIAFQ AKPGLTGILG PSGCGKSLTL QALAGILKPD NGSIRMDGQT        60
     WFDSERRIHV KPRDRKTGYV FQSYALFPHL TVAENIAYGL KGLPKTEIRE KVANWLDLIK       120
     LKGFGQRYPS QLSGGQKQRV ALARSMITEP KLLLLDEPFS ALDEHIKRQL EEDMLRLLGE       180
     HYNGIALLVT HNIEEAYRLG EDGMLFHEGR VLQQGPRDEV LRSPSSIPAA EIIGTENIFS       240
     APAPLTVKEE HIQIGNARFP LPPSSDSDTV HGMAVHAHDI RLASQEEDSG GPHHYQGELI       300
     RTIPGVRQAM LIVNIGGVHW RLSAQESRGL KAGDTLTVSI PPKAIHILR                   349
//

If you have problems or comments...

PBIL Back to PBIL home page