(data stored in ACNUC7421 zone)

EMBL: CP001791.PE320

CP001791.PE320       Location/Qualifiers
FT   CDS             complement(344376..345047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0332"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rso:RS05467 hypothetical protein; TIGRFAM:
FT                   molybdate ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97872"
FT                   /db_xref="GOA:D6XWN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN0"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ADH97872.1"
FT                   /translation="MIDISLFPLFLSLRVALTATVLAILIGIPIAYFLHKSQNRFSTLL
FT                   DTLITLPIVLPPTVLGYYLLVLLGRNSSIGRFLEDSFGITIVFTPTGAVIAALVVSIPF
FT                   MIKSAKTAFSSVEDDILHSAEILGRSKLNIFLTVTIPLAWRGIVAGISMTFARALGDFG
FT                   ATLMVAGSIPNETMTMPIAIYDALLAGDRVMANTLVAIMTIVAVTILYTINRLEKRVIQ
FT                   G"
     MIDISLFPLF LSLRVALTAT VLAILIGIPI AYFLHKSQNR FSTLLDTLIT LPIVLPPTVL        60
     GYYLLVLLGR NSSIGRFLED SFGITIVFTP TGAVIAALVV SIPFMIKSAK TAFSSVEDDI       120
     LHSAEILGRS KLNIFLTVTI PLAWRGIVAG ISMTFARALG DFGATLMVAG SIPNETMTMP       180
     IAIYDALLAG DRVMANTLVA IMTIVAVTIL YTINRLEKRV IQG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page