(data stored in ACNUC7421 zone)

EMBL: CP001791.PE321

CP001791.PE321       Location/Qualifiers
FT   CDS             complement(345053..345835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0333"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="KEGG: mca:MCA1378 molybdenum ABC transporter,
FT                   periplasmic molybdate-binding protein; TIGRFAM: molybdenum
FT                   ABC transporter, periplasmic molybdate-binding protein;
FT                   PFAM: extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97873"
FT                   /db_xref="GOA:D6XWN1"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN1"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADH97873.1"
FT                   /translation="MNMSNKGAFIILAFGSMLVAACGNDNDIEKHTLSVAAASDLGPAF
FT                   RELAENFEADHGISLSFSFGSTGQLADQIENGAPFDVFASANVSFIERLVESGDIIEES
FT                   TTPYAFGRIGLMMQATDEGIADDLYDLTSPDINRISIANPAHAPYGMAAEDALITSGML
FT                   DEVEDKLIYGRNITDAFVQIETGNAEVGIIAYSLGRANEDNFHFILLDEDLHEPIEQVI
FT                   GVVSYSEHQDAGQAFIDYIIHGEGKETMEHFGFYVPEE"
     MNMSNKGAFI ILAFGSMLVA ACGNDNDIEK HTLSVAAASD LGPAFRELAE NFEADHGISL        60
     SFSFGSTGQL ADQIENGAPF DVFASANVSF IERLVESGDI IEESTTPYAF GRIGLMMQAT       120
     DEGIADDLYD LTSPDINRIS IANPAHAPYG MAAEDALITS GMLDEVEDKL IYGRNITDAF       180
     VQIETGNAEV GIIAYSLGRA NEDNFHFILL DEDLHEPIEQ VIGVVSYSEH QDAGQAFIDY       240
     IIHGEGKETM EHFGFYVPEE                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page