(data stored in ACNUC7421 zone)

EMBL: CP001791.PE322

CP001791.PE322       Location/Qualifiers
FT   CDS             complement(346091..347128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0334"
FT                   /product="Arabinan endo-1,5-alpha-L-arabinosidase"
FT                   /EC_number="3.2.1.99"
FT                   /note="KEGG: scl:sce1485 putative Beta-xylosidase; PFAM:
FT                   glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97874"
FT                   /db_xref="GOA:D6XWN2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN2"
FT                   /inference="protein motif:PRIAM:3.2.1.99"
FT                   /protein_id="ADH97874.1"
FT                   /translation="MGIYQLSFRGFTVALLSATWLLAACTTDTPGGDVAGGIEMSGDIG
FT                   DYNPEEGVDDPVHDPAVLKSEDEYVLFSTGIERDPSDPGGIFMRKSADNLGGPWESIGE
FT                   IPVPEWIDPFEPNHLWAPMAIKQDERCFLYFSVSSFGSNRSAIGVASSSSPLDPASWED
FT                   HGILIESGAGTSFNAIDPHVFEYEGQLWLTFGSHFSGIHIIEMESPTQINSAMNPQLLQ
FT                   SRPGVPHNPVEAPSIIERNGYFYLFTSWDQCCSGLDSTYKIAVGRSDKPEGPYFDQEGE
FT                   PLVQGGGTILLEEEGNQIGPGGQDVYSEDGTDYLIHHYYDADADGVIRFQIRELSWEDD
FT                   WPTLE"
     MGIYQLSFRG FTVALLSATW LLAACTTDTP GGDVAGGIEM SGDIGDYNPE EGVDDPVHDP        60
     AVLKSEDEYV LFSTGIERDP SDPGGIFMRK SADNLGGPWE SIGEIPVPEW IDPFEPNHLW       120
     APMAIKQDER CFLYFSVSSF GSNRSAIGVA SSSSPLDPAS WEDHGILIES GAGTSFNAID       180
     PHVFEYEGQL WLTFGSHFSG IHIIEMESPT QINSAMNPQL LQSRPGVPHN PVEAPSIIER       240
     NGYFYLFTSW DQCCSGLDST YKIAVGRSDK PEGPYFDQEG EPLVQGGGTI LLEEEGNQIG       300
     PGGQDVYSED GTDYLIHHYY DADADGVIRF QIRELSWEDD WPTLE                       345
//

If you have problems or comments...

PBIL Back to PBIL home page