(data stored in ACNUC7421 zone)

EMBL: CP001791.PE323

CP001791.PE323       Location/Qualifiers
FT   CDS             347751..349142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0335"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rlg:Rleg_6112 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97875"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97875.1"
FT                   /translation="MMKKAMWLLGASALVLAGCGGNGNDDGGNDAAANDGNNNAATEGD
FT                   GGELEEQVVIGDDVEGATELTFWNFQELHTRLFEDAVERWNEEFPDRAIQLTAETYPYD
FT                   QMHNNLLLSLQSGSGAPDIADIELNQYPNFMRGEPQLEIMNDIVELELENFVASRFEIY
FT                   GKDGNYYGIPYHVGATVMYYNEEIMNEAGVDIDSIVTWDDYIEAGKQVVENTDAVMTTV
FT                   ESDETWSFYPLISQRESDYFDENGELILDNEINVDTLQFLHDLVYEHEIAQLTPGGFHH
FT                   AEEYYGFMNDGGAASLVMPMWYMGRFTDYMEDLSGKMQIRPLPLWEEGGNRTAGMGGTG
FT                   TVVTNQTEHAELAKDFLAYAKMSPESSIKLWEILGFDPPRHDVWDSEEIREPNHFYEYF
FT                   HDDIFDILLSLRDEVNDLNITEYNPDVTQELESSVFHSVLREQSQSPQDALEQAAEAVR
FT                   SRMID"
     MMKKAMWLLG ASALVLAGCG GNGNDDGGND AAANDGNNNA ATEGDGGELE EQVVIGDDVE        60
     GATELTFWNF QELHTRLFED AVERWNEEFP DRAIQLTAET YPYDQMHNNL LLSLQSGSGA       120
     PDIADIELNQ YPNFMRGEPQ LEIMNDIVEL ELENFVASRF EIYGKDGNYY GIPYHVGATV       180
     MYYNEEIMNE AGVDIDSIVT WDDYIEAGKQ VVENTDAVMT TVESDETWSF YPLISQRESD       240
     YFDENGELIL DNEINVDTLQ FLHDLVYEHE IAQLTPGGFH HAEEYYGFMN DGGAASLVMP       300
     MWYMGRFTDY MEDLSGKMQI RPLPLWEEGG NRTAGMGGTG TVVTNQTEHA ELAKDFLAYA       360
     KMSPESSIKL WEILGFDPPR HDVWDSEEIR EPNHFYEYFH DDIFDILLSL RDEVNDLNIT       420
     EYNPDVTQEL ESSVFHSVLR EQSQSPQDAL EQAAEAVRSR MID                         463
//

If you have problems or comments...

PBIL Back to PBIL home page