(data stored in ACNUC7421 zone)

EMBL: CP001791.PE324

CP001791.PE324       Location/Qualifiers
FT   CDS             349258..350181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0336"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_0127 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97876"
FT                   /db_xref="GOA:D6XWN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97876.1"
FT                   /translation="MASVDQNQQKQTNGFFKFLYSKKAAPYIFVSPFIISFLLLFLYPM
FT                   ISAVNMSFQRVLPGQIDYIGLHNYSRVFNPTFYTALQNTTIYVVWTVILLTFIPLIFAV
FT                   FLNHRLMKFTNFFRAAIFIPALTSVIVAGTIFRMIFGDSDSAFANQVLQLIGLDTVEWR
FT                   YGAGSGMFLMVALASWRWMGVNILYYLAALQNVNYDLYEAADIDGAGVWQKFRHVTFPA
FT                   IKPVVIFLSTITMINGFRMFEESFVFWETSSPGNIGLTVVGYIYVEGIQRNDMGFGAAV
FT                   GVVLLIIILVVSIIQLILTGAFKKDD"
     MASVDQNQQK QTNGFFKFLY SKKAAPYIFV SPFIISFLLL FLYPMISAVN MSFQRVLPGQ        60
     IDYIGLHNYS RVFNPTFYTA LQNTTIYVVW TVILLTFIPL IFAVFLNHRL MKFTNFFRAA       120
     IFIPALTSVI VAGTIFRMIF GDSDSAFANQ VLQLIGLDTV EWRYGAGSGM FLMVALASWR       180
     WMGVNILYYL AALQNVNYDL YEAADIDGAG VWQKFRHVTF PAIKPVVIFL STITMINGFR       240
     MFEESFVFWE TSSPGNIGLT VVGYIYVEGI QRNDMGFGAA VGVVLLIIIL VVSIIQLILT       300
     GAFKKDD                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page