(data stored in ACNUC7421 zone)

EMBL: CP001791.PE325

CP001791.PE325       Location/Qualifiers
FT   CDS             350181..351032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0337"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xfm:Xfasm12_1605 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97877"
FT                   /db_xref="GOA:D6XWN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97877.1"
FT                   /translation="MMKQKNRNDKLISISLFVFFTIVAIVALFPVASLVVAAFSPASDL
FT                   MRFGLTAELFFSAWDFTNMNAIFSGEGGNYWQWYLNSLIISGGLIIVSLFFSSMVGYAL
FT                   ALYEFKGQRFVFVLVLLIVMIPFEILMLPLFRLMTSLQLVDTYIAVMLPLIVAPIAVFF
FT                   FRQYAIGLPKELMESARVDGCTEYGIFFKIMAPLMLPSFAAMAILQGLTSWNNFLWPLL
FT                   VLRSNDMFTLPVGLATLLTPYGNNYEVLFSGAVLSIIPIIILFLFFQKFFIAGLTSGGV
FT                   KG"
     MMKQKNRNDK LISISLFVFF TIVAIVALFP VASLVVAAFS PASDLMRFGL TAELFFSAWD        60
     FTNMNAIFSG EGGNYWQWYL NSLIISGGLI IVSLFFSSMV GYALALYEFK GQRFVFVLVL       120
     LIVMIPFEIL MLPLFRLMTS LQLVDTYIAV MLPLIVAPIA VFFFRQYAIG LPKELMESAR       180
     VDGCTEYGIF FKIMAPLMLP SFAAMAILQG LTSWNNFLWP LLVLRSNDMF TLPVGLATLL       240
     TPYGNNYEVL FSGAVLSIIP IIILFLFFQK FFIAGLTSGG VKG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page