(data stored in ACNUC7421 zone)

EMBL: CP001791.PE326

CP001791.PE326       Location/Qualifiers
FT   CDS             351064..351729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0338"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   GPT1; GABA/polyamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97878"
FT                   /db_xref="GOA:D6XWN6"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN6"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97878.1"
FT                   /translation="MTVKLDAFFRLITRFSLLNVNWIAGIVAGLLVLGLFPATVATFII
FT                   TRRWIREGESFSVTKAYWQAYKQVFVKANLFGIGLSAIGLLLYVNYRVIQTGGIEIPLV
FT                   VTVSFITIVFLYLLFAAAVIPVSIHFTGTPLKLIQKTIWFIFAKPHLAVLLVLLMWGIA
FT                   HVSLLVPAAILFFTGSVGAYTVMWIFLSSLDKISGIEEVQSETDQPETLSLSNRRILT"
     MTVKLDAFFR LITRFSLLNV NWIAGIVAGL LVLGLFPATV ATFIITRRWI REGESFSVTK        60
     AYWQAYKQVF VKANLFGIGL SAIGLLLYVN YRVIQTGGIE IPLVVTVSFI TIVFLYLLFA       120
     AAVIPVSIHF TGTPLKLIQK TIWFIFAKPH LAVLLVLLMW GIAHVSLLVP AAILFFTGSV       180
     GAYTVMWIFL SSLDKISGIE EVQSETDQPE TLSLSNRRIL T                           221
//

If you have problems or comments...

PBIL Back to PBIL home page