(data stored in ACNUC7421 zone)

EMBL: CP001791.PE328

CP001791.PE328       Location/Qualifiers
FT   CDS             353264..354226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0340"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="KEGG: eca:ECA3793 putatuve glycosysl hydrolase;
FT                   PFAM: glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97880"
FT                   /db_xref="GOA:D6XWN8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN8"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ADH97880.1"
FT                   /translation="MTQSYDYKNPVIEQRADPWMYKHTDGYYYFTASVPEYDRIEVRRA
FT                   KTIEGLKGATPAVVWRKYDEGPLSANIWAPEIHYIDGAWYIYFAAARTTETDNGLFDHR
FT                   MYALACQSNNPVEGTWEEKGQVKSKWESFCLDATVFEHKGDHYYVWAQKDPDIEGNSNM
FT                   YIDKMVNPWTLKGDQVMISQPEYEWEKVGFYVNEGAAVIKRNGKIFMTFSGSATDHNYR
FT                   MGLLYADEESDLLNPSSWHKLDKPVFATSEENGQYGPGHNSFTTSEDGEKDLLVYHARN
FT                   YKEIDGDPLYDPNRHTRVQAFEWDENGFPVFEKPVPDAD"
     MTQSYDYKNP VIEQRADPWM YKHTDGYYYF TASVPEYDRI EVRRAKTIEG LKGATPAVVW        60
     RKYDEGPLSA NIWAPEIHYI DGAWYIYFAA ARTTETDNGL FDHRMYALAC QSNNPVEGTW       120
     EEKGQVKSKW ESFCLDATVF EHKGDHYYVW AQKDPDIEGN SNMYIDKMVN PWTLKGDQVM       180
     ISQPEYEWEK VGFYVNEGAA VIKRNGKIFM TFSGSATDHN YRMGLLYADE ESDLLNPSSW       240
     HKLDKPVFAT SEENGQYGPG HNSFTTSEDG EKDLLVYHAR NYKEIDGDPL YDPNRHTRVQ       300
     AFEWDENGFP VFEKPVPDAD                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page