(data stored in ACNUC7421 zone)

EMBL: CP001791.PE329

CP001791.PE329       Location/Qualifiers
FT   CDS             354278..354973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0341"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="KEGG: pmu:PM1244 L-ribulose-5-phosphate 4-epimerase;
FT                   TIGRFAM: L-ribulose-5-phosphate 4-epimerase; PFAM: class II
FT                   aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97881"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN9"
FT                   /inference="protein motif:TFAM:TIGR00760"
FT                   /protein_id="ADH97881.1"
FT                   /translation="MTLSKLKQEVCEANKALPKHGLVTFTWGNVSGIDREQGLVVIKPS
FT                   GVAYEDLTPESMVVVNLDGEVVEGELKQSSDTPTHVCLYNHFESIGGIVHTHSPNATSW
FT                   AQAGKELIALGTTQADYFYGDVPCTRAMTNEEIETAYERETGLVIVETFTKRNLDPVAM
FT                   PGVLVHSHAPFAWGTSPEDAVHNAVVLEECAKMAMQSLQLNAGAPRMNQALLDKHYLRK
FT                   HGKNAYYGQ"
     MTLSKLKQEV CEANKALPKH GLVTFTWGNV SGIDREQGLV VIKPSGVAYE DLTPESMVVV        60
     NLDGEVVEGE LKQSSDTPTH VCLYNHFESI GGIVHTHSPN ATSWAQAGKE LIALGTTQAD       120
     YFYGDVPCTR AMTNEEIETA YERETGLVIV ETFTKRNLDP VAMPGVLVHS HAPFAWGTSP       180
     EDAVHNAVVL EECAKMAMQS LQLNAGAPRM NQALLDKHYL RKHGKNAYYG Q                231
//

If you have problems or comments...

PBIL Back to PBIL home page