(data stored in ACNUC7421 zone)

EMBL: CP001791.PE331

CP001791.PE331       Location/Qualifiers
FT   CDS             356694..358172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0343"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="KEGG: spe:Spro_2243 L-arabinose isomerase; PFAM:
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97883"
FT                   /db_xref="GOA:D6XWP1"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP1"
FT                   /inference="protein motif:PRIAM:5.3.1.4"
FT                   /protein_id="ADH97883.1"
FT                   /translation="MINRPYSFWFLTGSQHLYGPETLDQVAAQSEEIIDGLNEAGLPFP
FT                   IEAKQVLTNSDDIRDVIIAANADPSCAGVITWMHTFSPSKIWIRGLQLLQKPMLHLNTQ
FT                   HNRDIPWDQIDMDFMNLNQSAHGDREFGSVVTRLGIDRKVVVGHWQHPDVQADISSWMV
FT                   TAMGHQESYHVKVARFGDNMRRVAVTDGDKVEAQNVFGWTVDGFGVGDLVAYIDKVTDE
FT                   ETESLFDEYDKLYRISDEIKQTPALKQSVLEQARIELGMKAFLDTEGYNAFTTTFEDLH
FT                   GMKQLPGLAAQRLMAQGYGFAGEGDWKTAALLRLMKVMAGHEQTTFMEDYTYHFEPDNE
FT                   MVLGSHMLEVCPTVAEDKPEIKVHPLGIGGKDDPARLVFNGQGGKGVNVSLVDIGTRFR
FT                   LIISEVEAQVPDKETPELPVAKLLWKPEPSLSTATAAWVHAGGAHHTVLTFSLTVDQML
FT                   DWAEMHGIEAAVINGETDIHQFKKELKWNELVWK"
     MINRPYSFWF LTGSQHLYGP ETLDQVAAQS EEIIDGLNEA GLPFPIEAKQ VLTNSDDIRD        60
     VIIAANADPS CAGVITWMHT FSPSKIWIRG LQLLQKPMLH LNTQHNRDIP WDQIDMDFMN       120
     LNQSAHGDRE FGSVVTRLGI DRKVVVGHWQ HPDVQADISS WMVTAMGHQE SYHVKVARFG       180
     DNMRRVAVTD GDKVEAQNVF GWTVDGFGVG DLVAYIDKVT DEETESLFDE YDKLYRISDE       240
     IKQTPALKQS VLEQARIELG MKAFLDTEGY NAFTTTFEDL HGMKQLPGLA AQRLMAQGYG       300
     FAGEGDWKTA ALLRLMKVMA GHEQTTFMED YTYHFEPDNE MVLGSHMLEV CPTVAEDKPE       360
     IKVHPLGIGG KDDPARLVFN GQGGKGVNVS LVDIGTRFRL IISEVEAQVP DKETPELPVA       420
     KLLWKPEPSL STATAAWVHA GGAHHTVLTF SLTVDQMLDW AEMHGIEAAV INGETDIHQF       480
     KKELKWNELV WK                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page